missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90649

Invitrogen™ Human CD151 (aa 118-215) Control Fragment Recombinant Protein

Catalog No. RP90649
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90649 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Catalog No. RP90649 missing translation for 'mfr' Invitrogen™ missing translation for 'supplierNo' RP90649
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82439 (PA5-82439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.

Specifications

Accession Number P48509
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 977
Name Human CD151 (aa 118-215) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD 151; CD151; CD151 antigen; CD151 antigen (Raph blood group); CD151 molecule; CD151 molecule (Raph blood group); GP27; hemidesmosomal tetraspanin CD151; membrane glycoprotein SFA-1; MER2; Peta3; PETA-3; platelet endothelial tetraspan antigen-3; platelet surface glycoprotein gp27; platelet-endothelial cell tetraspan antigen 3; platelet-endothelial tetraspan antigen 3; RAPH; SFA1; SFA-1; Tetraspanin-24; TSPAN24; tspan-24
Common Name CD151
Gene Symbol CD151
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less