missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101183

Invitrogen™ Human CCL1 (aa 45-93) Control Fragment Recombinant Protein

Catalog No. RP101183
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101183 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101183 Supplier Invitrogen™ Supplier No. RP101183

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62067 (PA5-62067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8.

Specifications

Accession Number P22362
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6346
Name Human CCL1 (aa 45-93) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BF534335; C-C motif chemokine 1; C-C motif chemokine ligand 1; CCL 1; Ccl1; CCR8 ligand; chemokine (C-C motif) ligand 1; I-309; inflammatory cytokine I-309; P500; SCYA1; SISe; SIS-epsilon; small inducible cytokine A1; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); small-inducible cytokine A1; T lymphocyte-secreted protein I-309; TCA3; TCA-3; T-cell activation protein 3
Common Name CCL1
Gene Symbol CCL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less