missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105169

Invitrogen™ Human CCDC64 (aa 364-438) Control Fragment Recombinant Protein

Catalog No. RP105169
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105169 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105169 Supplier Invitrogen™ Supplier No. RP105169

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66367 (PA5-66367. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC64 is a component of secretory vesicle machinery in developing neurons that acts as a regulator of neurite outgrowth. It regulates the secretory vesicle transport by controlling the accumulation of Rab6-containing secretory vesicles in the pericentrosomal region restricting anterograde secretory transport during the early phase of neuronal differentiation, thereby inhibiting neuritogenesis.

Specifications

Accession Number Q6ZP65
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92558
Name Human CCDC64 (aa 364-438) Control Fragment
Quantity 100 μL
Gene Alias 2210403N09Rik; Bicaudal D related 1; bicaudal D-related protein 1; bicaudal-D-related protein 1; BICD family like cargo adaptor 1; BICD family-like cargo adapter 1; Bicdl1; Bicdr1; BICDR-1; BICD-related protein 1; Ccdc64; CCDC64A; coiled-coil domain containing 64; coiled-coil domain-containing protein 64 A; H_267D11.1; RGD1310292; WUGSC:H_267D11.1
Common Name CCDC64
Gene Symbol BICDL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less