missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93443

Invitrogen™ Human CCDC57 (aa 272-356) Control Fragment Recombinant Protein

Catalog No. RP93443
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93443 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93443 Supplier Invitrogen™ Supplier No. RP93443

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54759 (PA5-54759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC57 (Coiled-Coil Domain Containing 57) is a Protein Coding gene. Diseases associated with CCDC57 include Uterine Benign Neoplasm and Reproductive Organ Benign Neoplasm. An important paralog of this gene is CCHCR1.

Specifications

Accession Number Q2TAC2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284001
Name Human CCDC57 (aa 272-356) Control Fragment
Quantity 100 μL
Gene Alias CCDC57; coiled-coil domain containing 57; coiled-coil domain-containing protein 57
Common Name CCDC57
Gene Symbol CCDC57
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTRKKEEETFKRKHEELDRLAREKDAVLVAVKGAHVEQLQELQTRVLELQAHCETLEAQLRRAEWRQADTAKEKDAAIDQLREDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less