missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105614

Invitrogen™ Human CCDC144A (aa 313-393) Control Fragment Recombinant Protein

Catalog No. RP105614
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105614 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105614 Supplier Invitrogen™ Supplier No. RP105614

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65466 (PA5-65466, PA5-140239 (PA5-140239. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC144A (Coiled-Coil Domain Containing 144A) is a Protein Coding gene. An important paralog of this gene isENSG00000266302.

Specifications

Accession Number A2RUR9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9720
Name Human CCDC144A (aa 313-393) Control Fragment
Quantity 100 μL
Gene Alias CCDC144A; coiled-coil domain containing 144 A; coiled-coil domain-containing protein 144 A; KIAA0565
Common Name CCDC144A
Gene Symbol CCDC144A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEEDASEISVSVVFETFPEQKEPSLKNIIHPYYHPYSGSQEHVCQSSSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less