missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92890

Invitrogen™ Human CAT1 (aa 473-567) Control Fragment Recombinant Protein

Catalog No. RP92890
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92890 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92890 Supplier Invitrogen™ Supplier No. RP92890

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110860. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT gene suggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge. The alternatively splicing of this gene results in three distinct isoforms, one of which contains an N-terminial mitochondrial transit peptide, and has been shown to be located in mitochondria.

Specifications

Accession Number P43155
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 1384
Name Human CAT1 (aa 473-567) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias amino acid transporter, cationic 1; ATRC1; AW107812; CARAT; Carnitine acetylase; carnitine acetyltransferase; Carnitine O-acetyltransferase; CAT; CAT1; CAT-1; Crat; Ecotropic retroviral leukemia receptor homolog; ecotropic retroviral receptor; ecotropic retrovirus receptor homolog; ERR; HCAT1; High affinity cationic amino acid transporter 1; REC1L; SLC7A1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; solute carrier family 7 member 1; System Y+ basic amino acid transporter
Common Name CAT1
Gene Symbol CRAT
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less