missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98957

Invitrogen™ Human CARD8 (aa 425-513) Control Fragment Recombinant Protein

Catalog No. RP98957
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98957 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98957 Supplier Invitrogen™ Supplier No. RP98957
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59852 (PA5-59852. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis is related to many diseases and development. Cell death signals are transduced by death domain (DD), death effector domain (DED), and caspase recruitment domain (CARD) containing molecules. CARD containing proteins include some caspases, Apaf-1, CARD4, IAPs, RICK, ARC, RAIDD, BCL-10, and ASC. A novel CARD-containing protein was recently identified and designated CARD8. This protein interacts with DRAL, a p53-responsive protein implicated in the induction of apoptosis, and caspase-1 and its related proteins ICEBERG and pesudo-ICE. Although there are conflicting reports on whether CARD8 acts a pro- or anti-apoptotic protein, it has been suggested that it functions as an adaptor molecule regulating caspase-1 and NF-kappa-B activation.

Specifications

Accession Number Q9Y2G2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22900
Name Human CARD8 (aa 425-513) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Apoptotic protein NDPP1; CARD 8; CARD inhibitor of NF-kappaB-activating ligands; CARD8; CARDINAL; CARD-inhibitor of NF-kappa-B-activating ligand; caspase recruitment domain family member 8; caspase recruitment domain family, member 8; caspase recruitment domain-containing protein 8; DACAR; DAKAR; DKFZp779L0366; KI; KIAA0955; NDPP; NDPP1; TUCAN; Tumor up-regulated CARD-containing antagonist of CASP9; tumor up-regulated CARD-containing antagonist of caspase nine
Common Name CARD8
Gene Symbol CARD8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less