missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment Recombinant Protein

Catalog No. RP93943
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93943 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93943 Supplier Invitrogen™ Supplier No. RP93943

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55154. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic anhydrase XII (CA XII), encoded by the CA12 gene, is one of the enzyme isoforms in the carbonic anhydrase family that catalyzes the reversible hydration of carbon dioxide into bicarbonate and protons. CA XII is a transmembrane protein expressed in various tissues, including the kidneys, intestines, and lungs, playing crucial roles in maintaining acid-base balance, pH regulation, and electrolyte transport. Its activity is significant in organs where fluid secretion and absorption are essential processes, impacting functions such as respiration and renal bicarbonate reabsorption. CA XII is involved in physiological processes like cell proliferation and differentiation by modulating the extracellular and intracellular pH, influencing tumor microenvironment dynamics. Aberrant expression of CA XII has been noted in several cancers, including breast and colorectal cancers, where it supports tumor growth and metastasis by maintaining the acid-base homeostasis conducive to cancer cell survival. Due to its surface expression and role in maintaining pH balance, CA XII is a target of interest for therapeutic interventions aiming to disrupt tumor progression and enhance the efficacy of cancer treatments.

Specifications

Accession Number Q8N1Q1
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 377677
Name Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2310075C21Rik; Ca13; Car13; Carbonate dehydratase XIII; carbonic anhydrase 13; Carbonic anhydrase XIII; CAXIII; CA-XIII; RGD1560453
Common Name Carbonic Anhydrase XIII
Gene Symbol Ca13
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less