missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Calumenin (aa 74-128) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109870
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144996 (PA5-144996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Caluminin is a 315 amino acid Ca2+-binding member of the CREC, EF-hand protein family. Calumenin is a secreted protein t hat contains six Ca2+-binding (EF-hand) motifs and is expressed in the lumen of the endoplasmic reticulum (ER) and Golgi apparatus. In the presence of Ca2+, Calumenin interacts with serum amyloid P component (SAP) and, together, they may play a role in the immunological defense system and participate in amyloidosis, the pathological formation of amyloid deposits in different types of tissues. Calumenin has an inhibitory effect on the vitamin K-dependent g-carboxylation system which converts vitamin K-dependent proteins to Gla-containing proteins. Calumenin may also be involved in the pathophysiology of thrombosis and/or wound healing by acting in an autocrine or paracrine manner.Specifications
| O43852 | |
| Blocking Assay, Control | |
| 813 | |
| 100 μL | |
| 9530075H20Rik; CALU; Calumenin; Cbp50; CBP-50; Crocalbin; crocalbin-like protein; IEF SSP 9302; multiple EF-hand protein; Rcn; reticulocalbin | |
| Calu | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Calumenin (aa 74-128) Control Fragment | |
| RUO | |
| Calumenin | |
| Unconjugated | |
| Recombinant | |
| GKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |