missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101636

Invitrogen™ Human Calreticulin (aa 100-231) Control Fragment Recombinant Protein

Catalog No. RP101636
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101636 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101636 Supplier Invitrogen™ Supplier No. RP101636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calr or Calreticulin is a calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. Calr, a lectin, interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Calr also interacts with with the DNA-binding domain of NR3C1 and mediates its nuclear export. It may also be involved in maternal gene expression regulation and oocyte maturation via the regulation of calcium homeostasis.

Specifications

Accession Number P27797
Concentration 1.04 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 811
Name Human Calreticulin (aa 100-231) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Autoantigen RO; CABP3; CALBP; calcium-binding protein 3; CALR; calrectulin; calregulin; Calreticulin; calreticulin precursor; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL-S-99n; I79_008346; RO; Ro/SS-A Antigen; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA
Common Name Calreticulin
Gene Symbol CALR
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less