missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Calpain 8 (aa 572-634) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107958
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67316 (PA5-67316. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Calcium-regulated non-lysosomal thiol-protease. Involved in membrane trafficking in the gastric surface mucus cells (pit cells) and may involve the membrane trafficking of mucus cells via interactions with coat protein. Proteolytically cleaves the beta- subunit of coatomer complex.Specifications
| A6NHC0 | |
| Blocking Assay, Control | |
| 388743 | |
| 100 μL | |
| calpain 8; calpain-8; CAPN8; NCL2; nCL-2; New calpain 2; stomach-specific M-type calpain | |
| CAPN8 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Calpain 8 (aa 572-634) Control Fragment | |
| RUO | |
| Calpain 8 | |
| Unconjugated | |
| Recombinant | |
| FDGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTAL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |