missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Calpain 6 (aa 498-595) Control Fragment Recombinant Protein

Catalog No. RP98332
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98332 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98332 Supplier Invitrogen™ Supplier No. RP98332
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83496 (PA5-83496. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calpain-6, also known as calpamodulin or calpain-X, is an intracellular, calcium-dependent cysteine protease. Calpain-6 has a much more tissue-specific expression in adults than the ubiquitous calpain-1 and calpain-2, and has thus far been found primarily in the placenta, although it is expressed embryonically in a number of tissues. The classical calpain family members consist of a common small subunit (calpain-4), and a large variable subunit, but it is not known if calpain-6 associates with a small subunit. Domains in the large subunit include the amino terminal domain-I, the proteinase domain-II, domain-III, and the EF-hand domain-IV (domain T in calpains 5 and 6). Located on the X chromosome, the calpain-6 sequence lacks the 'EF hand' calcium-binding motif found in domain-IV of the classical calpains. In addition, the canonical active site Cys, His and Asn are modified to Lys, His, Asn in human and Lys, Tyr, Asn in mouse calpain-6, making it unlikely that calpain-6 is proteolytically active.

Specifications

Accession Number Q9Y6Q1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 827
Name Human Calpain 6 (aa 498-595) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias calpain 6; calpain-6; Calpain-like protease X-linked; calpamodulin; CalpM; CANPX; Capa6; CAPN6; CAPNX; DJ914P14.1
Common Name Calpain 6
Gene Symbol CAPN6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less