missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CACNG3 (aa 203-239) Control Fragment Recombinant Protein

Catalog No. RP109621
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109621 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109621 Supplier Invitrogen™ Supplier No. RP109621

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium Channel gamma-3 is a member of voltage dependent calcium channels (VDCCs) which allows neurons to tailor calcium signaling to functionally discrete cellular regions. Although N-Type VDCCs exist before birth which is consistent with a role in migration, most N-Type VDCCs subunit expression is postnatal, and important in the genesis of synaptic transmission in discrete hippocampal fields. Calcium Channel gamma-3 is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. Further, Calcium Channel gamma-3 is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. Calcium Channel gamma-3 gene dysfunction is a susceptibility locus for childhood absence epilepsy.

Specifications

Accession Number O60359
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10368
Name Human CACNG3 (aa 203-239) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Cacng3; CACNLB3; calcium channel, voltage-dependent, gamma subunit 3; calcium voltage-gated channel auxiliary subunit gamma 3; CaVgamma3; neuronal voltage-gated calcium channel gamma-3 subunit; TARP gamma-3; transmembrane AMPAR regulatory protein gamma-3; Voltage-dependent calcium channel gamma-3 subunit; voltage-gated calcium channel gamma subunit
Common Name CACNG3
Gene Symbol Cacng3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less