missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CABIN1 (aa 1720-1800) Control Fragment Recombinant Protein

Catalog No. RP95344
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95344 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95344 Supplier Invitrogen™ Supplier No. RP95344
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60313 (PA5-60313. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcineurin binding protein (Cabin-1) and the corresponding rat homolog, designated Cain, are widely expressed nuclear phosphoproteins that regulate the serine/threonine phosphotase activity of calcineurin and influence T cell signaling and apoptosis. Calcineurin is required for the transcriptional activation of cytokines and the activation of various transcription factors, including NFAT, NFκB and AP-1, involved in T cell receptor (TCR)-mediated signaling. The regulation of calcineurin depends on the changes in intracellular calcium concentrations and the activity of protein kinase C. TCR activation results in PKC inducing the hyperphosphorylation of Cabin-1, which facilitates the high affinity binding of Cabin-1 to calcineurin. This complex formation, in turn, inhibits calcineurin activity and attenuates TCR-mediated signaling. Cabin-1 also associates directly with MEF-2 proteins, a family of transcription factors that regulate apoptosis signaling in T cells. This association between Cabin-1 and MEF-2 leads to the inhibition of MEF-2-mediated gene transcription and the inhibition of apoptosis.

Specifications

Accession Number Q9Y6J0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23523
Name Human CABIN1 (aa 1720-1800) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A330070M20Rik; CABIN1; CAIN; calcineurin binding protein 1; calcineurin binding protein cabin 1; calcineurin inhibitor; Calcineurin-binding protein cabin-1; KB-318B8.7; KIAA0330; Ppp3in; protein phosphatase 3 inhibitor
Common Name CABIN1
Gene Symbol CABIN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less