missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CA052 (aa 90-181) Control Fragment Recombinant Protein

Catalog No. RP94391
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94391 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94391 Supplier Invitrogen™ Supplier No. RP94391
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57510 (PA5-57510. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1orf52 gene ontology annotations related to this gene include RNA binding.

Specifications

Accession Number Q8N6N3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 148423
Name Human CA052 (aa 90-181) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BAG; BCL10-associated gene protein; C1orf52; chromosome 1 open reading frame 52; gm117; RP11-234D19.1; UPF0690 protein C1orf52
Common Name CA052
Gene Symbol C1orf52
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less