missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C5orf30 (aa 1-77) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100252
Description
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60364 (PA5-60364. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Specifications
| Q96GV9 | |
| Blocking Assay, Control | |
| 90355 | |
| 100 μL | |
| C5orf30; chromosome 5 open reading frame 30; UNC119-binding protein C5orf30; UPF0684 protein C5orf30 | |
| C5orf30 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C5orf30 (aa 1-77) Control Fragment | |
| RUO | |
| C5orf30 | |
| Unconjugated | |
| Recombinant | |
| MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |