missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107004

Invitrogen™ Human C3orf10 (aa 1-69) Control Fragment Recombinant Protein

Catalog No. RP107004
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107004 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107004 Supplier Invitrogen™ Supplier No. RP107004

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66323 (PA5-66323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Specifications

Accession Number Q8WUW1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55845
Name Human C3orf10 (aa 1-69) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6720456B07Rik; AW011779; BRICK1 subunit of SCAR/WAVE actin nucleating complex; BRICK1, SCAR/WAVE actin nucleating complex subunit; BRICK1, SCAR/WAVE actin-nucleating complex subunit; BRICK1, SCAR/WAVE actin-nucleating complex subunit, homolog; BRK1; C22H3orf10; C3orf10; haematopoietic stem/progenitor cell protein 300; hHBrk1; HSPC300; MDS027; Probable protein BRICK1; protein BRICK1; protein BRICK1-like protein; zgc:86903
Common Name C3orf10
Gene Symbol BRK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less