missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105297

Invitrogen™ Human C2orf47 (aa 152-202) Control Fragment Recombinant Protein

Catalog No. RP105297
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105297 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105297 Supplier Invitrogen™ Supplier No. RP105297
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66656 (PA5-66656, PA5-84889 (PA5-84889. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

Specifications

Accession Number Q8WWC4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79568
Name Human C2orf47 (aa 152-202) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430016H08Rik; AA409999; C2orf47; C78988; chromosome 2 open reading frame 47; m-AAA protease-interacting protein 1, mitochondrial; Maip1; Matrix AAA peptidase-interacting protein 1; MGC94335; RIKEN cDNA 9430016H08 gene; similar to hypothetical protein FLJ22555; uncharacterized protein C2orf47 homolog, mitochondrial; uncharacterized protein C2orf47, mitochondrial
Common Name C2orf47
Gene Symbol MAIP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less