missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102633

Invitrogen™ Human C2orf43 (aa 101-177) Control Fragment Recombinant Protein

Catalog No. RP102633
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102633 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102633 Supplier Invitrogen™ Supplier No. RP102633
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57035 (PA5-57035. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C2orf43 is a protein coding gene.

Specifications

Accession Number Q9H6V9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60526
Name Human C2orf43 (aa 101-177) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110057K04Rik; C2orf43; hLDAH; LDAH; LD-associated hydrolase; lipid droplet associated hydrolase; lipid droplet-associated hydrolase; Lipid droplet-associated serine hydrolase; mLDAH; RGD1311648; similar to hypothetical protein FLJ21820; UPF0554 protein C2orf43; UPF0554 protein C2orf43 homolog
Common Name C2orf43
Gene Symbol LDAH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less