missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95882

Invitrogen™ Human C2CD2 (aa 506-588) Control Fragment Recombinant Protein

Catalog No. RP95882
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95882 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95882 Supplier Invitrogen™ Supplier No. RP95882

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56591 (PA5-56591. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q9Y426
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25966
Name Human C2CD2 (aa 506-588) Control Fragment
Quantity 100 μL
Gene Alias 5730563M15; 5830404H04Rik; AI314146; AI449533; BF168443; C2 calcium dependent domain containing 2; C2 calcium-dependent domain containing 2; C2 domain-containing protein 2; C21orf25; C21orf258; C2cd2; Kiaa4045; mKIAA4045; ORF25; RGD735112; TMEM24 related geme; TMEM24L; Transmembrane protein 24-like
Common Name C2CD2
Gene Symbol C2CD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less