missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91768

Invitrogen™ Human C21orf59 (aa 9-101) Control Fragment Recombinant Protein

Catalog No. RP91768
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91768 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91768 Supplier Invitrogen™ Supplier No. RP91768
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53908 (PA5-53908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of the C21orf59 protein remains unknown.

Specifications

Accession Number P57076
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56683
Name Human C21orf59 (aa 9-101) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C21orf48; C21orf59; CFAP298; chromosome 21 open reading frame 59; CILD26; Cilia- and flagella-associated protein 298; FBB18; Kur; prostate cancer upregulated protein 1; Protein kurly homolog; UPF0769 protein C21orf59
Common Name C21orf59
Gene Symbol C21ORF59
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less