missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101690

Invitrogen™ Human C1QTNF8 (aa 111-160) Control Fragment Recombinant Protein

Catalog No. RP101690
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101690 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101690 Supplier Invitrogen™ Supplier No. RP101690

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63304 (PA5-63304. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1QTNF8 is a protein coding gene.

Specifications

Accession Number P60827
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 390664
Name Human C1QTNF8 (aa 111-160) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C1q and TNF related 8; C1q and tumor necrosis factor related protein 8; C1q/TNF-related protein 8; C1QTNF8; Complement C1q tumor necrosis factor-related protein 8; CTRP8; UNQ5829; UNQ5829/PRO19648
Common Name C1QTNF8
Gene Symbol C1QTNF8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less