missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109861

Invitrogen™ Human C1ql1 (aa 178-220) Control Fragment Recombinant Protein

Catalog No. RP109861
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109861 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109861 Supplier Invitrogen™ Supplier No. RP109861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145002. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1QL1 gene ontology annotations related to this gene include maintenance of synapse structure; motor learning; neuron remodeling.

Specifications

Accession Number O75973
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10882
Name Human C1ql1 (aa 178-220) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias C1q and tumor necrosis factor-related protein 14; C1q related factor; C1q/TNF-related protein 14; C1ql1; C1q-related factor; C1QRF; C1QTNF14; complement C1q like 1; Complement component 1 Q subcomponent-like 1; complement component 1, q subcomponent-like 1; CRF; CTRP14; gliacolin; LOW QUALITY PROTEIN: C1q-related factor
Common Name C1ql1
Gene Symbol C1QL1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less