missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C1orf57 (aa 32-95) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP103184
Description
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84192 (PA5-84192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Belonging to the THEP1 NTPase family, C1orf57 (also known as nucleoside triphosphate phosphohydrolase), and its mouse homolog, 2310079N02Rik, are 190 amino acid proteins that has nucleotide phosphatase activity towards ATP, GTP, TTP, CTP and UTP. Acting as a monomer, it also hydrolyzes nucleoside diphosphates with lower efficiency. The gene encoding C1orf57 maps to human chromosome 1, the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The mechanism of rapidly enhanced aging is unclear and is a topic of continuing exploration. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinson's, Gaucher disease and Usher syndrome are also associated with chromosome 1.Specifications
| Q9BSD7 | |
| Blocking Assay, Control | |
| 84284 | |
| 100 μL | |
| 2310079N02Rik; AI449709; C1orf57; cancer-related nucleoside-triphosphatase; Cancer-related nucleoside-triphosphatase homolog; CH1073-266P11.1; HCR-NTPase; NTPase; Ntpcr; Nucleoside triphosphate phosphohydrolase; nucleoside-triphosphatase C1orf57 homolog; nucleoside-triphosphatase, cancer-related; RGD1306192; RP4-659I19.2; RP4-678E16.2; zgc:92420 | |
| Ntpcr | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C1orf57 (aa 32-95) Control Fragment | |
| RUO | |
| C1orf57 | |
| Unconjugated | |
| Recombinant | |
| PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |