missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human C19orf39 (aa 32-120) Control Fragment Recombinant Protein

Catalog No. RP99179
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99179 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99179 Supplier Invitrogen™ Supplier No. RP99179
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62669 (PA5-62669. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q6NVH7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 126074
Name Human C19orf39 (aa 32-120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310047B19Rik; ATPase SWSAP1; C19orf39; SWIM type zinc finger 7 associated protein 1; SWIM-type zinc finger 7 associated protein 1; SWIM-type zinc finger 7-associated protein 1; SWS1AP1; SWS1-associated protein 1; Swsap1; zinc finger, SWIM-type containing 7 associated protein 1; ZSWIM7AP1; ZSWIM7-associated protein 1
Common Name C19orf39
Gene Symbol SWSAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less