missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98563

Invitrogen™ Human C16orf48 (aa 221-291) Control Fragment Recombinant Protein

Catalog No. RP98563
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98563 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98563 Supplier Invitrogen™ Supplier No. RP98563
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59586 (PA5-59586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of C16orf48 remains unknown.

Specifications

Accession Number Q9H0I2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84080
Name Human C16orf48 (aa 221-291) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI606951; C16orf48; C18H16orf48; cp048; DAKV6410; E130303B06Rik; ENKD1; enkurin domain containing 1; enkurin domain-containing protein 1; hypothetical protein LOC524652; RGD1307357; uncharacterized protein C16orf48 homolog; UNQ6410/PRO21183
Common Name C16orf48
Gene Symbol ENKD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less