missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C14orf4 (aa 317-395) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100055
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62256 (PA5-62256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May contribute to the control of female reproductive function. May play a role in gene transcription by transactivating GNRH1 promoter and repressing PENK promoter.Specifications
| Q9H1B7 | |
| Blocking Assay, Control | |
| 64207 | |
| 100 μL | |
| C14orf4; EAP1; enhanced at puberty 1; enhanced (at puberty protein 1; interferon regulatory factor 2 binding protein like; interferon regulatory factor 2 binding protein-like; interferon regulatory factor 2-binding protein-like; IRF2BPL; KIAA1865; My039; Probable E3 ubiquitin-protein ligase IRF2BPL) | |
| IRF2BPL | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C14orf4 (aa 317-395) Control Fragment | |
| RUO | |
| C14orf4 | |
| Unconjugated | |
| Recombinant | |
| SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |