missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90821

Invitrogen™ Human C10orf118 (aa 122-245) Control Fragment Recombinant Protein

Catalog No. RP90821
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90821 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90821 Supplier Invitrogen™ Supplier No. RP90821
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53195 (PA5-53195. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC186 (Coiled-Coil Domain Containing 186) is a Protein Coding gene. [GeneCards]

Specifications

Accession Number Q7Z3E2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55088
Name Human C10orf118 (aa 122-245) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810028B20Rik; A630007B06Rik; AI159700; C10orf118; CCDC186; coiled-coil domain containing 186; coiled-coil domain-containing protein 186; CTCL tumor antigen HD-CL-01/L14-2; CTCL tumor antigen L14-2; FLJ10188; FLJ35301; oocyte-testis gene 1 protein; Otg1; RGD1307158
Common Name C10orf118
Gene Symbol CCDC186
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRSSTFPESANEKTYSESPYDTDCTKKFISKIKSVSASEDLLEEIESELLSTEFAEHRVPNGMNKGEHALVLFEKCVQDKYLQQEHIIKKLIKENKKHQELFVDICSEKDNLREELKKRTETEK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less