missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91809

Invitrogen™ Human BTG3 (aa 96-165) Control Fragment Recombinant Protein

Catalog No. RP91809
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91809 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91809 Supplier Invitrogen™ Supplier No. RP91809

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53788 (PA5-53788. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.

Specifications

Accession Number Q14201
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10950
Name Human BTG3 (aa 96-165) Control Fragment
Quantity 100 μL
Gene Alias Abundant in neuroepithelium area protein; ANA; APRO4; B cell translocation gene 3; B-cell translocation gene 3; BTG anti-proliferation factor 3; BTG family member 3; BTG family, member 3; Btg3; btg3 {ECO:0000312; Protein BTG3; protein Tob5; rBTG3; RGD:2226}; TOB5; TOB55; TOFA
Common Name BTG3
Gene Symbol BTG3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less