missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105262

Invitrogen™ Human BRICD5 (aa 169-206) Control Fragment Recombinant Protein

Catalog No. RP105262
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105262 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105262 Supplier Invitrogen™ Supplier No. RP105262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66590 (PA5-66590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BRICD5 is a protein coding gene.

Specifications

Accession Number Q6PL45
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 283870
Name Human BRICD5 (aa 169-206) Control Fragment
Quantity 100 μL
Gene Alias BRICD5; BRICHOS domain containing 5; BRICHOS domain-containing protein 5; BRICHOS domain-containing protein C16orf79; C16orf79
Common Name BRICD5
Gene Symbol BRICD5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLEVDPAQAGALVQRLCMRTPIYWARRAEGPRRQRLIY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less