missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human BRE (aa 6-103) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92060
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82604 (PA5-82604. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
BRCC45 was initially suggested to be a housekeeping protein that is highly expressed in brain and reproductive organs. Later experiments indicated BRCC45 forms a complex with the breast and ovarian predisposition proteins BRCA1 and BRCA2 as well as RAD51 and BRCC36. This complex has a ubiquitin E3 ligase activity and is thought to enhance cellular survival following DNA damage. BRCC45 has also been suggested to function as a death receptor-associated anti-apoptotic protein by inhibiting the BID-induced activation of the mitochondrial apoptotic pathway. Higher levels of BRCC45 were detected in the majority of hepatocellular carcinomas, suggesting that BRCC45 may promote tumorigenesis when overexpressed. At least three isoforms of BRCC45 are known to exist.Specifications
| Q9NXR7 | |
| Blocking Assay, Control | |
| 9577 | |
| 100 μL | |
| 6030405P19Rik; AI429776; B830038C02Rik; BABAM2; brain and reproductive organ-expressed (TNFRSF1A modulator); brain and reproductive organ-expressed protein; BRCA1/BRCA2-containing complex subunit 45; BRCA1/BRCA2-containing complex, subunit 4; BRCA1-A complex subunit BRE; BRCC4; BRCC45; BRE; bre {ECO:0000312; BRISC and BRCA1-A complex member 2; RGD:735111} | |
| BABAM2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human BRE (aa 6-103) Control Fragment | |
| RUO | |
| BRE | |
| Unconjugated | |
| Recombinant | |
| ALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALQNLA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |