missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Bestrophin 3 (aa 322-462) Control Fragment Recombinant Protein

Catalog No. RP91144
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91144 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91144 Supplier Invitrogen™ Supplier No. RP91144
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62985 (PA5-62985. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BEST3 belongs to the bestrophin family of anion channels, which includes BEST1, the gene mutant in vitelliform macular dystrophy (VMD), and 2 other BEST1-like genes, BEST2 and BEST4. Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. Each of the 4 bestrophin genes has a unique 3-prime end of variable length.

Specifications

Accession Number Q8N1M1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 144453
Name Human Bestrophin 3 (aa 322-462) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BEST3; bestrophin 3; bestrophin-3; mBest4; vitelliform macular dystrophy 2-like 3; vitelliform macular dystrophy 2-like protein 3; Vmd2l3
Common Name Bestrophin 3
Gene Symbol BEST3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDSSMFLPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less