missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Bestrophin 1 (aa 470-602) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105072
Description
Highest antigen sequence indentity to the following orthologs: Mouse (20%), Rat (20%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The retinal pigment epithelium (RPE) and choroid represent a differentiated system of the eye that sustains normal retinal health and function. Best vitelliform macular dystrophy, known as Best disease, is an early-onset autosomal dominant condition in which accumulation of lipofuscin-like material within and beneath the RPE leads to progressive loss of central vision. The lipofuscin-like material in the macular area appears as a yellow mass like the yolk of an egg that later becomes darker and irregular in color, a process known as 'scrambling the egg'. Best disease is frequently a reflection of mutations in the Bestrophin gene, which encodes a protein containing four putative transmembrane domains and localizes to the basolateral plasma membrane of RPE cells. Human Bestrophin forms oligomeric chloride channels that are sensitive to intracellular calcium. Missense mutations at the Bestrophin locus reduces or abolishes Bestrophin protein mediated membrane current. The human Bestrophin gene encodes a 585 amino acid protein.Specifications
| O76090 | |
| Blocking Assay, Control | |
| 7439 | |
| 100 μL | |
| ARB; BEST; BEST 1; Best disease; best macular dystrophy; BEST1; Best1V1Delta2; bestrophin; bestrophin 1; Bestrophin1; Bestrophin-1; BMD; Bmd1; LOW QUALITY PROTEIN: bestrophin-1; mBest1; RP50; TU15B; vitelliform macular dystrophy (Best disease, bestrophin); vitelliform macular dystrophy 2 homolog; vitelliform macular dystrophy protein 2; Vitelliform macular dystrophy protein 2 homolog; VMD 2; Vmd2 | |
| BEST1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Bestrophin 1 (aa 470-602) Control Fragment | |
| RUO | |
| Bestrophin 1 | |
| Unconjugated | |
| Recombinant | |
| SQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRSVLHLNQGHCIALCPTPASLALSLPFLHNFLGFHHCQSTLDLRPALAWGIYLATFTGILGKCSGPFLTSPWYHPEDFLGPGE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |