missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BCR (aa 2-75) Control Fragment Recombinant Protein

Catalog No. RP96534
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96534 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96534 Supplier Invitrogen™ Supplier No. RP96534
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83413 (PA5-83413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number P11274
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 613
Name Human BCR (aa 2-75) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5133400C09Rik; ABL; AI561783; AI853148; ALL; BCR; BCR activator of RhoGEF and GTPase; BCR protein; BCR, RhoGEF and GTPase activating protein; bcr/abl; BCR/FGFR1 chimera protein; BCR1; breakpoint cluster region; breakpoint cluster region homolog; breakpoint cluster region protein; c-ABL; c-abl oncogene 1; CML; D22S11; D22S662; EC 2.7.11.1; FGFR1/BCR chimera protein; JTK7; Kiaa3017; mKIAA3017; p150; PHL; renal carcinoma antigen NY-REN-26; RP11-83J21.1; v-abl
Common Name Bcr
Gene Symbol Bcr
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less