missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97546

Invitrogen™ Human BCO2 (aa 18-102) Control Fragment Recombinant Protein

Catalog No. RP97546
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97546 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97546 Supplier Invitrogen™ Supplier No. RP97546
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58945 (PA5-58945. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BCDO2 catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism.

Specifications

Accession Number Q9BYV7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83875
Name Human BCO2 (aa 18-102) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ab2-079; b,b-carotene-9',10'-dioxygenase; BCDO2; Bcmo2; Bco2; B-diox-II; beta,beta-carotene 9',10'-dioxygenase variant 1; beta,beta-carotene 9',10'-dioxygenase variant 2; beta,beta-carotene 9',10'-dioxygenase variant 3; beta,beta-carotene 9',10'-oxygenase; beta-carotene 9', 10'-dioxygenase 2; beta-carotene 9',10' oxygenase; beta-carotene 9',10'-dioxygenase 2; beta-carotene dioxygenase 2; beta-carotene oxygenase 2; beta-diox-II; carotenoid 9',10' monooxygenase II; carotenoid 9',10' monoxygenase II; carotenoid-9',10'-cleaving dioxygenase; CMO2
Common Name BCO2
Gene Symbol BCO2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less