missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BCL6B (aa 255-325) Control Fragment Recombinant Protein

Catalog No. RP101832
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101832 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101832 Supplier Invitrogen™ Supplier No. RP101832
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63671 (PA5-63671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. BCL6B may function in a narrow stage or be related to some events in the early B-cell development.

Specifications

Accession Number Q8N143
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 255877
Name Human BCL6B (aa 255-325) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B cell CLL/lymphoma 6, member B; B cell CLL/lymphoma 6 B; BAZF; B-cell CLL/lymphoma 6 member B protein; B-cell CLL/lymphoma 6, member B; B-cell CLL/lymphoma 6, member B (zinc finger protein); B-cell CLL/lymphoma 6 B; Bcl6-associated zinc finger protein; Bcl6b; BCL6B transcription repressor; BCL6B, transcription repressor; LOW QUALITY PROTEIN: B-cell CLL/lymphoma 6 member B protein; RGD1563179; ZBTB28; zinc finger protein 62; ZNF62
Common Name BCL6B
Gene Symbol BCL6B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less