missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human BCL2L15 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94533
Description
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56243 (PA5-56243. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Proteins of the Bcl-2 family are critical regulators of apoptosis. Proapoptotic members, like Bax, contain three of the four Bcl-2 homology regions (BH1-3), while BH3-only proteins, like Bim, possess only the short BH3 motif. Database searches revealed Bfk, an unusual novel member of the Bcl-2 family that contains a BH2 and BH3 region but not BH1 or BH4. Bfk is thus most closely related to Bcl-G(L). It lacks a C-terminal membrane anchor and is cytosolic. Enforced expression of Bfk weakly promoted apoptosis and antagonized Bcl-2's prosurvival function. Like Bcl-G(L), Bfk did not bind to any Bcl-2 family members, even though its BH3 motif can mediate association with prosurvival proteins. Low amounts of Bfk were found in stomach, ovary, bone marrow and spleen, but its level in the mammary gland rose markedly during pregnancy, suggesting that Bfk may play a role in mammary development.Specifications
| Q5TBC7 | |
| Blocking Assay, Control | |
| 440603 | |
| 100 μL | |
| BCL2 like 15; BCL2L15; bcl2-L-15; BCL2-like 15; bcl-2-like protein 15; BCLl2-like 15; Bfk; C1orf178; Gm566; pro-apoptotic Bcl-2 protein; RGD1562344 | |
| BCL2L15 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human BCL2L15 Control Fragment | |
| RUO | |
| BCL2L15 | |
| Unconjugated | |
| Recombinant | |
| QTGAILQNTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |