missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BCCIP (aa 192-287) Control Fragment Recombinant Protein

Catalog No. RP105943
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105943 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105943 Supplier Invitrogen™ Supplier No. RP105943
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65200 (PA5-65200. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene.

Specifications

Accession Number Q9P287
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56647
Name Human BCCIP (aa 192-287) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110013J05Rik; Bccip; BCCIPalpha; BCCIPbeta; BRCA2 and CDKN1A interacting protein; BRCA2 and CDKN1A-interacting protein; BRCA2 and Cip1/p21 interacting protein; cdk inhibitor p21 binding protein; p21- and CDK-associated protein 1; Protein TOK-1; TOK1; TOK-1; TOK-1 alpha; TOK-1 beta
Common Name BCCIP
Gene Symbol BCCIP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEEQGKPEVLGGPDTRRGLEPVPIQHNGGSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less