missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103082

Invitrogen™ Human BBX (aa 208-336) Control Fragment Recombinant Protein

Catalog No. RP103082
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103082 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103082 Supplier Invitrogen™ Supplier No. RP103082

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62227 (PA5-62227. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BBX gene ontology annotations related to this gene include DNA binding.

Specifications

Accession Number Q8WY36
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56987
Name Human BBX (aa 208-336) Control Fragment
Quantity 100 μL
Gene Alias 5530401J07Rik; 5730403O13Rik; Ag recognized by Treg cells 1; ARTC1; BBX; BBX high mobility group box domain containing; BBX, HMG-box containing; bobby sox homolog; bobby sox homolog (Drosophila); HBP2; HMG box transcription factor BBX; HMG box-containing protein 2; HMG-BOX transcription factor BBX; HSPC339; MDS001; x 001 protein
Common Name BBX
Gene Symbol BBX
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSMLLLAGEHALGTPEVSSGTCRPDVSESPELRQKSPLFQFAEISSSTSHSDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKSALFQLAEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less