missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human BBS1 (aa 169-264) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100237
Description
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63546 (PA5-63546. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development.Specifications
| Q8NFJ9 | |
| Blocking Assay, Control | |
| 582 | |
| 100 μL | |
| AI451249; Bardet-Biedl syndrome 1; Bardet-Biedl syndrome 1 (human); Bardet-Biedl syndrome 1 homolog; Bardet-Biedl syndrome 1 protein; Bardet-Biedl syndrome 1 protein homolog; BBS1; BBS2L2; BBS2-like protein 2; D19Ertd609e | |
| BBS1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human BBS1 (aa 169-264) Control Fragment | |
| RUO | |
| BBS1 | |
| Unconjugated | |
| Recombinant | |
| IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |