missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105711

Invitrogen™ Human B4GALT2 (aa 249-360) Control Fragment Recombinant Protein

Catalog No. RP105711
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105711 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105711 Supplier Invitrogen™ Supplier No. RP105711

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

B4GALT2 is one of type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue.

Specifications

Accession Number O60909
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8704
Name Human B4GALT2 (aa 249-360) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4-Gal; B4galt2; B4Gal-T2; B4Gal-T3; Beta-1,4-galactosyltransferase 2; beta-1,4-galactosyltransferase II; beta-1,4-GalTase 2; beta-4-GalT2; beta4Gal-T2; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; Ggtb2; Lactose synthase A protein; N-acetyllactosamine synthase; Nal synthase; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
Common Name B4GALT2
Gene Symbol B4galt2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less