missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101480

Invitrogen™ Human B3GALT5 (aa 26-80) Control Fragment Recombinant Protein

Catalog No. RP101480
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101480 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101480 Supplier Invitrogen™ Supplier No. RP101480

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63006 (PA5-63006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

B3GALT5 catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor. (Uniprot)

Specifications

Accession Number Q9Y2C3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10317
Name Human B3GALT5 (aa 26-80) Control Fragment
Quantity 100 μL
Gene Alias 1190002B21Rik; AU045265; B3GALT5; b3Gal-T5; b3Galt-V; B3GalTx; B3gt5; B3T5; Beta-1,3-galactosyltransferase 5; beta-1,3-GalTase 5; beta-3-galactosyltransferase 5; beta3GalT5; beta3Gal-T5; beta-3-Gx-T5; GLCT5; homolog of C. elegans Bt toxin resistance gene bre-5; SSEA-3 synthase; Stage-specific embryonic antigen 3 synthase; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
Common Name B3GALT5
Gene Symbol B3GALT5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less