missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ATP5S Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100133
Description
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61384 (PA5-61384. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ATP5S, also known as ATP synthase subunits, mitochondrial, ATP synthase-coupling factor B or ATP synthase, H+ transporting, mitochondrial F0 complex, subunits (factor B), is a 215 amino acid mitochondrial inner membrane protein that belongs to the ATP synthase subunits family. Involved in regulation of mitochondrial membrane ATP synthase, ATP5S is necessary for H+ conduction of ATP synthase. The ATP5S gene encodes subunits, also known as factor B, of the proton channel. This subunit is necessary for energy transduction in ATP synthase complexes. The ATP5S gene is conserved in chimpanzee, canine, bovine, mouse, rat, chicken, zebrafish and mosquito, and maps to human chromosome 14q21.3.Specifications
| Q99766 | |
| Blocking Assay, Control | |
| 27109 | |
| 100 μL | |
| 1110015E18Rik; ATP synthase coupling factor B, mitochondrial; ATP synthase coupling factor B-like 1; ATP synthase subunit s, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit S; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B); ATP synthase, H+ transporting, mitochondrial Fo complex subunit s (factor B); ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B); ATP synthase-coupling factor B; ATP5S; Atpw; Distal membrane arm assembly complex 2-like protein; DMAC2L; Factor B; facyor B; FB; HSU79253; Mitochondrial ATP synthase regulatory component factor B | |
| DMAC2L | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ATP5S Control Fragment | |
| RUO | |
| ATP5S | |
| Unconjugated | |
| Recombinant | |
| MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |