missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP100510

Invitrogen™ Human ATP Synthase beta (aa 50-191) Control Fragment Recombinant Protein

Catalog No. RP100510
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100510 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100510 Supplier Invitrogen™ Supplier No. RP100510

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81950 (PA5-81950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.

Specifications

Accession Number P06576
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 506
Name Human ATP Synthase beta (aa 50-191) Control Fragment
Quantity 100 μL
Gene Alias ATP synthase F1 subunit beta; ATP synthase subunit beta, mitochondrial; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; Atp5b; ATP5F1B; ATPMB; ATPSB; beta-subunit; epididymis secretory protein Li 271; f1-ATPase beta; F1-ATPase beta-subunit; F-1-ATPase beta-subunit precursor; fj13e04; fj55c09; HEL-S-271; hm:zehn0534; hypothetical protein LOC554135; im:6793121; MGC5231; mitochondrial ATP synthase beta subunit; mitochondrial ATP synthase subunit beta subunit; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; mitochondrial ATP synthetase, beta subunit; wu:fj13e04; wu:fj38d01; wu:fj55c09; zgc:111961
Common Name ATP Synthase beta
Gene Symbol ATP5F1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less