missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88910

Invitrogen™ Human ATL1 (aa 301-424) Control Fragment Recombinant Protein

Catalog No. RP88910
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88910 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88910 Supplier Invitrogen™ Supplier No. RP88910

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55652 (PA5-55652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

Accession Number Q8WXF7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51062
Name Human ATL1 (aa 301-424) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930435M24Rik; Adfsp; AD-FSP; ATL1; ATL1 alpha; ATL1 beta; ATL1 gamma; ATL1-delta; atlastin GTPase 1; atlastin1; atlastin-1; Bcl11B; BCL-11 B; BCL11B/TRDC fusion; brain-specific GTP-binding protein; Ctip 2; CTIP2; CTIP-2; Fsp1; GBP3; GBP-3; GTP-binding protein 3; guanine nucleotide-binding protein 3; guanylate-binding protein 3; hGBP3; hRit1; hRIT1 alpha; HSN1D; Rit 1; Rit1; spastic paraplegia 3 protein A; Spastic paraplegia 3 A homolog; SPG3; SPG3A; ZNF856B
Common Name ATL1
Gene Symbol ATL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less