missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88911

Invitrogen™ Human ATG2B (aa 1667-1806) Control Fragment Recombinant Protein

Catalog No. RP88911
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88911 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88911 Supplier Invitrogen™ Supplier No. RP88911

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51576 (PA5-51576. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Autophagy, the process of bulk degradation of cellular proteins through an autophagosomic-lysosomal pathway is important for normal growth control and may be defective in tumor cells. It is involved in the preservation of cellular nutrients under starvation conditions as well as the normal turnover of cytosolic components. This process is negatively regulated by TOR (Target of rapamycin) through phosphorylation of autophagy protein APG1. Another member of the autophagy family of proteins is ATG2B, one of two homologs of ATG2 that is essential for autophagosome formation and important for regulation of size and distribution of lipid droplets. Relatively high rates of ATG2B mutations were observed in gastric and colorectal carcinomas, suggesting that deregulating the autophagy process may contribute to cancer development.

Specifications

Accession Number Q96BY7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55102
Name Human ATG2B (aa 1667-1806) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410024A21Rik; AI047755; AI503411; ATG2 autophagy related 2 homolog B; Atg2b; autophagy related 2 B; autophagy-related protein 2 homolog B; AW558123; C030004M05Rik; C14orf103; C630028L02Rik; mKIAA4067; RGD1304878
Common Name ATG2B
Gene Symbol ATG2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CSKEMPRKAHSNMLTVKALHVCPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSAEVELQMTPDPEVKKSPGADVTCSLPRHLSTSKEPNLVISFSGPKQPSQNDSANSVEVVNGMEEKNFSAEEASFRDQPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less