missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97441

Invitrogen™ Human ATG16L2 (aa 262-348) Control Fragment Recombinant Protein

Catalog No. RP97441
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97441 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97441 Supplier Invitrogen™ Supplier No. RP97441
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61000 (PA5-61000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in autophagy. [UniProt]

Specifications

Accession Number Q8NAA4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 89849
Name Human ATG16L2 (aa 262-348) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410118P20Rik; APG16-like 2; ATG16 autophagy related 16-like 2; ATG16B; Atg16l2; Atg16L2 alpha; Atg16L2 beta; autophagy related 16 like 2; autophagy related 16-like 2; autophagy related 16-like 2 (S. cerevisiae); autophagy-related 16-like 2 alpha; autophagy-related 16-like 2 beta; autophagy-related protein 16-2; mFLJ00012 protein; RGD1311400; WD repeat-containing protein 80; WDR80
Common Name ATG16L2
Gene Symbol ATG16L2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less