missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92951

Invitrogen™ Human ASS1 (aa 164-241) Control Fragment Recombinant Protein

Catalog No. RP92951
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92951 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92951 Supplier Invitrogen™ Supplier No. RP92951
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82740 (PA5-82740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.

Specifications

Accession Number P00966
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 445
Name Human ASS1 (aa 164-241) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408052; arginino succinate synthetase; argininosuccinate synthase; argininosuccinate synthase 1; argininosuccinate synthetase; argininosuccinate synthetase 1; arginosuccinate synthetase 1; ASS; Ass1; Ass-1; ASSA; citrulline-aspartate ligase; citrulline--aspartate ligase; citrullinemia; CN; CTLN1; fold; mutant arginino succinate synthetase; RP11-618A20.2
Common Name ASS1
Gene Symbol ASS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less