missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105009

Invitrogen™ Human ASPH (aa 506-600) Control Fragment Recombinant Protein

Catalog No. RP105009
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105009 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105009 Supplier Invitrogen™ Supplier No. RP105009

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65929 (PA5-65929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Specifications

Accession Number Q12797
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 444
Name Human ASPH (aa 506-600) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310005F16Rik; 3110001L23Rik; A beta H-J-J; AAH; AI848629; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartate-beta-hydroxylase; aspartyl (asparaginyl) beta hydroxylase; aspartyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase-like; aspartyl/asparaginyl-beta-hydroxylase; ASPH; AW261690; AW561901; BAH; C79816; calsequestrin-binding protein; cardiac junctin; CASQ2BP1; cI-37; FDLAB; HAAH; humbug; JCTN; jumbug; junctate; junctin; junctional sarcoplasmic reticulum protein; peptide-aspartate beta-dioxygenase; Unknown (protein for MGC:137539)
Common Name ASPH
Gene Symbol Asph
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less