missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Asparagine Synthetase (aa 86-211) Control Fragment Recombinant Protein

Catalog No. RP88728
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88728 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88728 Supplier Invitrogen™ Supplier No. RP88728
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64898 (PA5-64898, PA5-56113 (PA5-56113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASNS (asparagine synthetase [glutamine-hydrolyzing]) is involved in the subpathway that synthesizes f L-asparagine from L-aspartate. Mutations affecting the gene can result in asparagine synthetase deficiency (ASNSD).

Specifications

Accession Number P08243
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 440
Name Human Asparagine Synthetase (aa 86-211) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ASNS; ASNSD; asparagine synthetase; asparagine synthetase (glutamine-hydrolyzing); asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; TS11; TS11 cell cycle control protein
Common Name Asparagine Synthetase
Gene Symbol Asns
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less